SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2S9M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D2S9M8
Domain Number - Region: 91-131
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0144
Family Phase 1 flagellin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2S9M8
Sequence length 134
Comment (tr|D2S9M8|D2S9M8_GEOOG) Uncharacterized protein {ECO:0000313|EMBL:ADB73741.1} KW=Complete proteome; Reference proteome OX=526225 OS=G-20). GN=Gobs_0980 OC=Geodermatophilus.
Sequence
MSTFDSLGISGSGLLVHRKWLDAVSDNIANINNVTSTDQDAFQERLIVAQAVDYGSGEGG
VRVARAEYGSAEGRMVHEPDHPLADANGYVRYPDIDLGDQMTQLIMAQRGYQANLAVVER
ATTAYQAALQLGKG
Download sequence
Identical sequences A0A1I0IJJ7 A0A1M7T207 D2S9M8
gi|284989558|ref|YP_003408112.1| WP_012947182.1.73408 WP_012947182.1.76031 WP_012947182.1.7867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]