SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2S9N8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2S9N8
Domain Number 1 Region: 1-298
Classification Level Classification E-value
Superfamily Phase 1 flagellin 8.89e-56
Family Phase 1 flagellin 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D2S9N8
Sequence length 298
Comment (tr|D2S9N8|D2S9N8_GEOOG) Flagellar hook-associated protein 3 {ECO:0000313|EMBL:ADB73751.1} KW=Complete proteome; Reference proteome OX=526225 OS=G-20). GN=Gobs_0990 OC=Geodermatophilus.
Sequence
MRITHRAVTQTALLGLNTNLSSVAKLQQQLTSGKLISAPSDSPTGTNKALQIRQDQSAVE
QFAKNISDGQSWLDATDTALNEAVAQVQRVRALTVQAMNDGAVSTSSQRAIAVEVAALRE
SLLGVANSSINDRALFGGVTQGSTAYSADGTYVGAPPVGEGITRRVSNADRIRIDVTGHE
AFGVPSPGNPDLFGLVGKIAADVGTAPDALSADLEQLDAALDRLLGAAASVGARSTRMEA
AGQVNTDLQLTLASQLVAVEDIDLAKTIMELSQTEVGYKAALQATAQVIQPTLVDFLR
Download sequence
Identical sequences D2S9N8
gi|284989568|ref|YP_003408122.1| WP_012947192.1.76031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]