SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D2SEX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2SEX0
Domain Number 1 Region: 18-316
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 8.11e-74
Family Acetamidase/Formamidase-like 0.0000974
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2SEX0
Sequence length 337
Comment (tr|D2SEX0|D2SEX0_GEOOG) Acetamidase/Formamidase {ECO:0000313|EMBL:ADB74660.1} KW=Complete proteome; Reference proteome OX=526225 OS=G-20). GN=Gobs_1964 OC=Geodermatophilus.
Sequence
MDVVEVTPTFEQYAFTFGGVAPLLRIRPGTALRVWSDDAFCGALRKTSDLSSEKVDLRFV
NPQTGPFWVEGAEPGDTLALHFVAMEPARDWGASAAIPFFGGLTSTDRVATLQDPLPDTT
WIYELDRAANTVTFAAQHTDLEIALPVEPMLGTVGVAPPGGEVRSSLVPERFGGNMDTPQ
MRPGTTCFLGVNVEGALFSIGDGHYRQGEGEACGTAVEGAMTTTVVVELVKGGAPTAFPT
WPRLEDDTHWMTVGSSRPLEDAWRIGQVELVRWFGELYGLHPMDAYQLLSQISEVPIANV
VDANYSTVVKARKSLLPRVAAYGGLHDDLRRRAATLR
Download sequence
Identical sequences D2SEX0
WP_012948099.1.76031 gi|284990477|ref|YP_003409031.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]