SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3EPI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3EPI4
Domain Number 1 Region: 10-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.55e-22
Family Anti-sigma factor antagonist SpoIIaa 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3EPI4
Sequence length 119
Comment (tr|D3EPI4|D3EPI4_ATETH) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome; Reference proteome OX=1453429 OS=Atelocyanobacterium thalassa (isolate ALOHA). GN=UCYN_06880 OC=Aphanothecaceae; Candidatus Atelocyanobacterium.
Sequence
MIGNHLIYFGTAVFEPNGYITSNNVSDFQKELNSFIKNNSCKKFLVDMEQVEFIDSTGLI
AMVSACRLAQSFNKKLSVCSLSPSVRIIFELTQLDQALEIYNDRQSYIYETSNNETLTI
Download sequence
Identical sequences D3EPI4
WP_012954071.1.87152 gi|284929243|ref|YP_003421765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]