SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3EYR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3EYR3
Domain Number 1 Region: 144-436
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.07e-24
Family Phase 1 flagellin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3EYR3
Sequence length 443
Comment (tr|D3EYR3|D3EYR3_CONWI) Flagellar hook-associated protein FlgK {ECO:0000313|EMBL:ADB48458.1} KW=Complete proteome; Reference proteome OX=469383 OS=ID131577). GN=Cwoe_0022 OC=Conexibacteraceae; Conexibacter.
Sequence
MPISSFMGLQTSLRGLIAHQQALNTTGHNVANANTPGFSRQEAIFGAMSALRLPTNSGTT
GLGAQLGTGVDVLGIRRIRDSFLDLQFRGTNMQLGDASARTQSLEQVELSFGEPSSSGIN
ALLGRFWDAWSALASAPEEGSAARTAVIEMANTLAGAFQTVHAQLTRVAAQAQGKYDEIT
GPAGDVDIWAQELAQLNRTIAHAVTVGQVPNDLMDRRDLLIDRLSELSQVSVTDVGDGSV
RVEFGGVTLVDPAAAGGYTWPQTLTSRDGKLGALRDLASPTGPALSFRDRLDTVAADLVA
RVNALHRAPGGVDFFAPAGTTADRISVVATAATVVAGSTADRGRNDVANAIAQLRNGSIN
RTYSALVSEVGSVVRRASSAEAIQQSLVDNIDDRRQSVQGVSPDEEMTNMIRFQRGYQAS
ARTMSTLDEMLDTLINRTGRVGL
Download sequence
Identical sequences D3EYR3
WP_012931511.1.44340 gi|284041493|ref|YP_003391833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]