SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3F431 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3F431
Domain Number 1 Region: 1-263
Classification Level Classification E-value
Superfamily Phase 1 flagellin 5.23e-93
Family Phase 1 flagellin 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3F431
Sequence length 263
Comment (tr|D3F431|D3F431_CONWI) Flagellin {ECO:0000256|RuleBase:RU362073} KW=Complete proteome; Reference proteome OX=469383 OS=ID131577). GN=Cwoe_0078 OC=Conexibacteraceae; Conexibacter.
Sequence
MSLRINTNVEAFNAHRNLEGTSSKLAKSMERLSSGFRINRAADDAAGLAISEKLRGQIGG
LNQARRNVQDGISLVQTAEGSLTEVHSMLQRVRELAVQHATGTLAREDRGAIASEIAQLT
QEVERIGTTSQFNGITLLDGRNATVAFQVGANDGETISVATVSLQARVGRLDQTSTLAQI
DTAIANVSDARAVFGAVQNRLEHTYNNLSVYQENLTASESRIRDVDMAAEMVNFTKNNIL
QQAGTSMLAQAQQAPQSVLSLLR
Download sequence
Identical sequences D3F431
WP_012931567.1.44340 gi|284041549|ref|YP_003391889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]