SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3NT28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3NT28
Domain Number 1 Region: 9-288
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 4.32e-100
Family Methylenetetrahydrofolate reductase 0.0000000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3NT28
Sequence length 301
Comment (tr|D3NT28|D3NT28_AZOS1) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome; Reference proteome OX=137722 OS=Azospirillum sp. (strain B510). GN=AZL_009190 OC=Rhodospirillaceae; Azospirillum.
Sequence
MTAPISAPPSISFEFFPPKTEKMEQSLWQSIRRLAPLSPGFVSVTYGAGGSTRERTHATV
CRIQAETGIPAAAHFTCVGATRDEIDAIARTYWDAGIRHLVALRGDPPETAGGVGGKYEP
FPGGYAYAADLVAGMKRIADFEISVAAYPEAHPEAPSAQFDLDNLKRKIDAGATRAITQF
FFDNDVYYRFLDRCAAAGIHVPIVPGILPITNFARAVEFADRCGASMPAKLAETFEGLDD
DPETRQLVAATVAAEQCQELQARGVNDFHFYTLNRSDLTIAICRMLGVKAKAAPAAAPVA
G
Download sequence
Identical sequences D3NT28
WP_012973543.1.27297 gi|288957760|ref|YP_003448101.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]