SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3PXS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3PXS6
Domain Number 1 Region: 5-266
Classification Level Classification E-value
Superfamily Cgl1923-like 6.28e-89
Family Cgl1923-like 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3PXS6
Sequence length 301
Comment (tr|D3PXS6|D3PXS6_STANL) Uncharacterized protein {ECO:0000313|EMBL:ADD43406.1} KW=Complete proteome; Reference proteome OX=446470 OS=102104 / LLR-40K-21). GN=Snas_3749 OC=Stackebrandtia.
Sequence
MPNGEDLYTVEADTPDISGAVMLVELRGFMDAGQAGQGVTEYLLKELDHQVVASFDVDEL
IDYRGRRPVMTFDTDHWVDYDAPRLRVYLMRDDVGVPFLLLSGDEPDLRWERFAEAVQSL
IEKFGIRLTVALHGIPMGAPHTRPLGVTAHGTDASLLPSGERTLNRLQVPGNAAALLELR
LGQAGHDAIGFAVHVPHYLAQASYPNASVRLLESLHQATGLSVSVESLREEGRVVDAEVD
SQVRASQEVSDVVAALERQYDMFDDSRPSLLVEESEEELPTGDELGEQFERFLAEQQRRS
E
Download sequence
Identical sequences D3PXS6
gi|291301221|ref|YP_003512499.1| WP_013018977.1.89426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]