SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3Q502 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3Q502
Domain Number 1 Region: 82-142
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000275
Family NfeD domain-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3Q502
Sequence length 144
Comment (tr|D3Q502|D3Q502_STANL) Uncharacterized protein {ECO:0000313|EMBL:ADD42182.1} KW=Complete proteome; Reference proteome OX=446470 OS=102104 / LLR-40K-21). GN=Snas_2500 OC=Stackebrandtia.
Sequence
MAWIIWLAVAVALGIAELFTLTFVLLMIGAGAAAASLAAALGSPVELQGLVFVVVSVLSL
IGIRPWAKKLRDNRSGPDAKIGLQALEGAEALVLERVDSQHGLIKVQGQEWTARSYDGKQ
VLEQGEEVNIVEIRGATAMVWRQP
Download sequence
Identical sequences D3Q502
WP_013017753.1.89426 gi|291299997|ref|YP_003511275.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]