SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3Q7Y1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3Q7Y1
Domain Number 1 Region: 26-283
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-65
Family Protein kinases, catalytic subunit 0.0000307
Further Details:      
 
Domain Number 2 Region: 448-594
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 0.00000256
Family PsbP-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3Q7Y1
Sequence length 595
Comment (tr|D3Q7Y1|D3Q7Y1_STANL) Serine/threonine protein kinase {ECO:0000313|EMBL:ADD40486.1} KW=Complete proteome; Reference proteome OX=446470 OS=102104 / LLR-40K-21). GN=Snas_0774 OC=Stackebrandtia.
Sequence
MTFPPDAAATPEGQTAPRVAQPGVVIADRYELTAKVGDGGHGTVWRAHDRLLQRDVAVKE
VTLPPYLPPDEREQLCDRTLREARAAASLSHASVVRVFDVVTEDGRPWIVMELLKARSLA
DIISADGPMPPRVVAKIGLSLVSALEAAHEAGIVHRDIKPGNVMISADGRCVLSDFGAAA
ASASGTGHTAPGMVLGSAHYIAPERAIGGPAEPPSDLFSLGVTLYAALEGRPPFDRGDTT
ATMHAVVHDPPEAPRNAGPLAPLLAGLLDKDPTQRFTVQHTRNTLTGLLSGPLSADGATG
VLPTSGGPISGIPASPGGFPVSAPPTSPAPTSAMPASGAPLGPVSGGPTSGGPVSGAAAP
GYPAGYAAATAEPYTPPVDPYYHQTGQPFPQPPKQQKKTGMLLGIGIGVVVLALLGTLGF
MMFGGSGEEPPSDDSGDDSQQDAAFETELYKDPDGRFTVEIPKGWKAAQKSNPEQTFLDI
TDPDNGDRWVRLNVLNEADPKAAVTGGVEGLKSSDKFVSGTLETVESKPAKLGDLKAHQV
EYTAERSSDGQKRHAMWLIASDGSTSYHVYLSVPQKTWKDSLPIFENAVKTYKIL
Download sequence
Identical sequences D3Q7Y1
gi|291298301|ref|YP_003509579.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]