SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3SUK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3SUK2
Domain Number 1 Region: 51-305
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000000000000803
Family Transferrin 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3SUK2
Sequence length 385
Comment (tr|D3SUK2|D3SUK2_NATMM) ABC-type transport system periplasmic substrate-binding protein (Probable substrate phosphate/phosphonate) {ECO:0000313|EMBL:ADD05260.1} KW=Complete proteome; Reference proteome OX=547559 OS=8861/ NBRC 102185 / NCIMB 2190 / MS3) (Natronobacterium magadii). GN=Nmag_1684 OC=Natrialba.
Sequence
MSQDSGTSTNSRRRFLTKTGAVGTLALAGCLGRSEETDGDGGNGSGDSTETITWVMNPAE
DTIDIEVQYQPLFELIEDEFDVEIEGLPTQSYSGTMVELERAGEGDMTLADTSPGAVPQL
GPEEIDVVGMREAFGAERYFGTLVTTADSGITDVSDLEGEAVAMADVGSVSGGMAPLWML
HEAGLDIGNVAEGGGAEDFEWRSGVSHDLAVEELINDDTIAAAGAGEFASVPHVPVEQIE
DEYPDLYEISPEVDIAGTRDPELRLLDVSPAIPRAPIVVNAGWQDDLRSDIEEFMQNVEA
EELQHDAFDLADELGLDLPDEMLEEYNEGTLDTDDYDLDEDQEADWQDFDDHTLWFSGIV
AADHEDYEPVRDFAEDLDIAFDDIE
Download sequence
Identical sequences D3SUK2
gi|289581356|ref|YP_003479822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]