SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3SXG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3SXG2
Domain Number 1 Region: 10-241
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.76e-24
Family Phosphate binding protein-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3SXG2
Sequence length 333
Comment (tr|D3SXG2|D3SXG2_NATMM) NMT1/THI5 like domain-containing protein {ECO:0000313|EMBL:ELY30582.1} KW=Complete proteome; Reference proteome OX=547559 OS=8861/ NBRC 102185 / NCIMB 2190 / MS3) (Natronobacterium magadii). GN=C500_08672 OC=Natrialba.
Sequence
MTNATVDFQLNWEPNGFQAPYFLARDRGFYEDEGLDVRFVEGHGSPFAAEQAAKGRAEFA
LAGASAVLSIQSRGLDPLAVAAVTGKTPAAIYTFRDEFGEALTDPDQLRGCTIAPSATKT
RILTAQLLEDEGISDEVDLLGVDDHTHHRVQHKLLDGRVDAAVGVVTNGYELEAEHDRQA
DELPIGDHLGVYGMMLVTSPEFASEEPETVRSFLRATARGWEAATTDPDAAIDVLVERNA
TLERNRPVEQRKFETAATDLQFTDRTRSEGWGLHDGERWQTLGQTLTETDLLEGEIDPDA
VWTNEFIDTEDDVIGNYAERVGESAETEAEPRT
Download sequence
Identical sequences D3SXG2
WP_004215526.1.6702 WP_004215526.1.81346 gi|289582007|ref|YP_003480473.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]