SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3T8X7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3T8X7
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily YjgF-like 6.98e-38
Family Chorismate mutase 0.000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3T8X7
Sequence length 115
Comment (tr|D3T8X7|D3T8X7_THEIA) Chorismate mutase AroH {ECO:0000256|PIRNR:PIRNR005965} KW=Complete proteome OX=580331 OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9). GN=Thit_1144 OC=Thermoanaerobacteraceae; Thermoanaerobacter.
Sequence
MKVIRGAITSQNTKEDILKDTTILIEEIIKANELEEKNIISIFFSATKDLDAVYPAEAVR
NMGMTSIPMMCLQEMEVKGSLSHCIRVAVFTNLSDDKEVKHIYLKEAKKLRPDLV
Download sequence
Identical sequences D3T8X7
gi|289578344|ref|YP_003476971.1| WP_012995204.1.100455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]