SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3VRI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3VRI9
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily PTS system IIB component-like 0.0000000000000419
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3VRI9
Sequence length 94
Comment (tr|D3VRI9|D3VRI9_MYCAA) Pentitol phosphotransferase enzyme II, Bcomponent {ECO:0000313|EMBL:CBH40936.1} KW=Complete proteome OX=2110 OS=Mycoplasma agalactiae. GN=MAGa7330 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MKVLCLCGSGMGTSMIIKLKTEQAMRELGIQGSVEALGLGMGKSVANNFDVILCTNNFVS
EVANSKASVHGLKNVMDINEIKAAFKDALAKGIK
Download sequence
Identical sequences A5IZ78 D3VRI9
WP_011949791.1.24405 WP_011949791.1.3023 gi|291320625|ref|YP_003515890.1| gi|148377900|ref|YP_001256776.1| 347257.MAG_6370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]