SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3YYF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3YYF3
Domain Number 1 Region: 33-185
Classification Level Classification E-value
Superfamily ALDH-like 4.97e-42
Family ALDH-like 0.0000000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3YYF3
Sequence length 185
Comment (tr|D3YYF3|D3YYF3_MOUSE) Aldehyde dehydrogenase, mitochondrial {ECO:0000313|Ensembl:ENSMUSP00000123545} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Aldh2 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MLRAALTTVRRGPRLSRLLSAAATSAVPAPNHQPEVFCNQIFINNEWHDAVSRKTFPTVN
PSTGEVICQVAEGNKDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYL
AALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVC
GQIIP
Download sequence
Identical sequences D3YYF3
ENSMUSP00000123545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]