SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3Z6B9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3Z6B9
Domain Number 1 Region: 320-809
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-165
Family ALDH-like 0.000000000793
Further Details:      
 
Domain Number 2 Region: 2-110
Classification Level Classification E-value
Superfamily Formyltransferase 1.1e-33
Family Formyltransferase 0.00000203
Further Details:      
 
Domain Number 3 Region: 114-214
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.04e-24
Family Post formyltransferase domain 0.0000132
Further Details:      
 
Domain Number 4 Region: 232-319
Classification Level Classification E-value
Superfamily ACP-like 0.00000772
Family Acyl-carrier protein (ACP) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D3Z6B9
Sequence length 810
Comment (tr|D3Z6B9|D3Z6B9_MOUSE) Mitochondrial 10-formyltetrahydrofolate dehydrogenase {ECO:0000313|Ensembl:ENSMUSP00000117076} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Aldh1l2 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MDVIDSPKHGSIIYHPSLLPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRS
CDVKPNDTVDSLYNRFLFPEGIKAMVEAVQLIADGKAPRTPQPEEGATYEGIQKKENAEV
SWDQPAEGLHNWIRGHDKVPGAWAEINGQMVTFYGSSLLTSSVPSGEPLDIRGAKKPGLV
TKNGLVLFGNDGKALMVRNLQFEDGKMIPASQYFSAGETSVVELTAEELKVAETIKVIWA
RILSNTPVIEDSTDFFKSGASSMDVVRLVEEIRQSCGGLQLQNEDVYMATKFGDFIQKVV
RRLRGEDEEAEMVVDYVSKEVNGMTVKIPYQCFINGQFVDAEDGETYATVNPTDGTTICR
VSYASLADVDRAVAAAKDAFENGEWGRMNARDRGRLMYRLADLMEENQEELATIEALDSG
AVYTLALKTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNYNLTFTKKEPLGACAIIIP
WNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELTVKAGFPKGVINIIPGSGGV
AGQRLSQHPDIRKLGFTGSTSVGKQIMKSCAVSNLKKVSLELGGKSPLIIFSDCDLEKAV
RMGMGAVFFNKGENCIAAGRLFVEEAIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHR
AHLEKLLQYCETGVQEGATLVYGGRQVQRPGFFMEPTVFTGVEDHMYLAKEESFGPIMVI
SKFQNGDIDGVLQRANNTEYGLASGVFTRDINKAMYVSDKLEAGTVFINTYNKTDVAAPF
GGMKQSGFGKDLGEEALNEYLKIKTVTLEY
Download sequence
Identical sequences D3Z6B9
ENSMUSP00000117076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]