SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3ZCV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ZCV0
Domain Number 1 Region: 15-256
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-87
Family Calponin-homology domain, CH-domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 274-396
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 510-631
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-31
Family Spectrin repeat 0.000000556
Further Details:      
 
Domain Number 4 Region: 391-505
Classification Level Classification E-value
Superfamily Spectrin repeat 8.11e-24
Family Spectrin repeat 0.000000514
Further Details:      
 
Domain Number 5 Region: 635-746
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-22
Family Spectrin repeat 0.000000565
Further Details:      
 
Domain Number 6 Region: 739-867
Classification Level Classification E-value
Superfamily EF-hand 3.49e-22
Family EF-hand modules in multidomain proteins 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D3ZCV0
Sequence length 894
Comment (tr|D3ZCV0|D3ZCV0_RAT) RCG30552 {ECO:0000313|EMBL:EDM06982.1} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_30552 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MNQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIE
NIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAE
EIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSW
KDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKP
DERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRT
IPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAF
MPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGK
EQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVN
DRCQKICDQWDRLGTLTQKRREALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQ
DMFIVHSIEEIQSLITAHEQFKATLPEADGERQSILAIQNEVEKVIQSYSIRISSSNPYS
TVTMDELRNKWDKVKQLVPVRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEI
ARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHI
RVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRA
CLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILAS
DKPYILAEELRRELPPDQAQYCIKRMPPYSGPGSVPGALDYTAFSSALYGESDL
Download sequence
Identical sequences D3ZCV0 Q9JI91
ENSMUSP00000067708 ENSMUSP00000129609 ENSMUSP00000067708 ENSRNOP00000024098 10090.ENSMUSP00000067708 10116.ENSRNOP00000024098 NP_001163796.1.100692 NP_001163796.1.4139 NP_150371.4.92730 XP_006980225.1.50099 XP_021071011.1.100879 ENSRNOP00000024098 ENSMUSP00000067708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]