SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3ZJE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ZJE2
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.44e-33
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 75-148
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 9.42e-19
Family Ribosomal protein L11, C-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3ZJE2
Sequence length 165
Comment (tr|D3ZJE2|D3ZJE2_RAT) Ribosomal protein L12, pseudogene 1 {ECO:0000313|Ensembl:ENSRNOP00000071492} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Rpl12-ps1 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHNGNITFDEIVNIARQMRHRS
LARELSGTIKEILGTAQSVGCNVDGHHPHDITDDINSGAMECPAS
Download sequence
Identical sequences D3ZJE2
ENSRNOP00000053979 ENSRNOP00000053979 10116.ENSRNOP00000053979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]