SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D3ZUW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D3ZUW2
Domain Number 1 Region: 176-577
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.31e-75
Family GABA-aminotransferase-like 0.0000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D3ZUW2
Sequence length 617
Comment (tr|D3ZUW2|D3ZUW2_RAT) RCG26239 {ECO:0000313|EMBL:EDL79599.1} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=rCG_26239 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MSENGKEVSSQAAKTESSTQTPSHWESIHSKPRDQLKKRSSRKKAFKILQEKMLKLQCVF
MDHFLQRTSQQMQCLPPGDQQCTRASRKQEKKMGFLLSQIINHIWSNTVKKLKFKVPPLP
CSDSRCGIKAGHQALSSWQTGQPRPRLGDFEDAFADRTLSKRGTGIYEFYHLSFQGYEAY
QTDKYHQDKNPSGYINLSTSENKLCLDLITARLTQCDMNFLDEAQLQYSDWKGEPSLREE
LASFLTHYCKAPTPLDPENVVVLNGCSSVFSSLVMVLCDPGDALLIPTPCYSGFTFSSYL
YSKVELIPVYLESQVTETNKYSFQLTVDKLKLTLTQAKKKGKKVKGLVLINPQNPLGDVY
TQGSLQEYLVFAKKHKLHVIMDEIYMLSVFEPTVTFHSILSIENLPDPNMIHMIWGTSKD
FGMSGIRFGVLYTHNKEVASAMKAFGYHHSVSGIIQYKLRQLLQDKEWINKVYLPKNHSR
LREAYSYVTKMLEDLKIPFCNCGSGLFVWINLKAYLNPCTFDQEQILHQRFQDKKLLLSS
GKSFMCIEPGWFRLVFAEKHPQLQVAMGQFCQVLAEHKKGETTEQQEKPTGTDDVDGCLH
PVAPDSPLSLAQAPPQK
Download sequence
Identical sequences D3ZUW2
10116.ENSRNOP00000063492 NP_001103064.1.100692 NP_001103064.1.4139 ENSRNOP00000063492 ENSRNOP00000063492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]