SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D4AD53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4AD53
Domain Number 1 Region: 223-465
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-51
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 64-177
Classification Level Classification E-value
Superfamily POZ domain 1.2e-27
Family Tetramerization domain of potassium channels 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D4AD53
Sequence length 514
Comment (sp|D4AD53|KCNG1_RAT) Voltage-gated potassium channel subunit Kv6.1 KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Kcng1; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MTLLPGDNSDYDYSALSCASDTSFHPAFFPQRQAIKGVFYRRAQRLGPQDDLHQSISLGD
RRRQIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILSVCDDYDVTCNEFFFDRN
PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMM
EREDEEEALDSEDQESEGPSTSEGRLSRCMRRLRDMVEKPHSGLPGKVFACLSVLFVTVT
AVNLSVSTLPSLREEEEQGQCSQMCHNVFIVESVCVGWFSLEFLLRFIQAPSKFAFLRSP
LTLIDLVAILPYYVTLLVDGAASSRRKPSTGNSYLDKVGLVLRVLRALRILYVMRLARHS
LGLQTLGLTARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVI
TMTTVGYGDMVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVLIR
RAQYLIKTKSQLSGMSQDSDILFGSASSDTRDNN
Download sequence
Identical sequences D4AD53
NP_001100015.1.100692 NP_001100015.1.4139 XP_008760706.1.100692 XP_017447105.1.100692 10116.ENSRNOP00000045232 ENSRNOP00000045232 ENSRNOP00000045232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]