SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D4AR50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D4AR50
Domain Number - Region: 17-47
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0811
Family Glutamine synthetase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D4AR50
Sequence length 1302
Comment (tr|D4AR50|D4AR50_ARTBC) 5'-3' exoribonuclease 1 {ECO:0000256|PIRNR:PIRNR006743} KW=Complete proteome; Reference proteome OX=663331 OS=(Trichophyton mentagrophytes). GN=ARB_06879 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MGVPKFFRWLSERYPAISQLIAENRIPEFDCLYLDMNGIIHNCTHKDSDSPTFRMTEDKM
FIAIFNYIEHLFGKIKPKRLFFMAIDGVAPRAKMNQQRARRFRTALDAELAKEKAIKEGV
EMPKEDAFDSNCITPGTEFMAKLTKQLKYFINKKVSEDAEWQGVEVVLSGHEVPGEGEHK
IMEYIRQAKAQPEYDPNMRHCLYGLDADLIMLGLLSHDPHFCLLREEVTFGRQSQKKSKE
LEHQNFYLLHLCIVREYLELEFQELKLDGALQFPFDMERIIDDFILMAFFVGNDFLPNLP
NLHINEGALAWMFKVYKDVLPKLGGYVNEHGTINMERLRTLLTALSDVEFRFFEAEYSDA
RWLKSKTLDGDQTPTLPEKPNVLTITPAQKHIFNRIKKYVTHRPMDEAGQPVPLDLSPSL
PARDRKFVEQLADSLHLKWSSVLNQHEERFLRVQLPTNDDDDDEDDDDDESQIAILRVLK
KYENAKVKEVTAEDAQMAAEKKYEKKFQDWKDKYYKGKFGWGLENTEEMRKLTENYVQGL
QWVLFYYYRGVASWPWFYRYHYAPMISDIHLGLGADVDFKLGQPFFPFQQLMGVLPDRSK
KIVPVAFHGLMTSPDSPIIDFYPRDFELDMNGKKMEWEAVVKIPFIEEERLLKAMATKEH
LLTPEEKARNTFGVTLKFTYSPDVEFLYPSSLPGIFPDVSRCRCIENVFELPTMEGLDPY
VGLVEGVKIGAEALYGFPSLQTLQQTGQLGFHGVCVFQQESRNESMVVTISDPEIGGNTA
DAKTKLGKRVHVGYPFLQEAKVVCVSDELFDYVQVDGEEHVVPIPHTPTQISQWKKKAEK
IESYYSKRLGMVIGDVETIVRVEMLKGLKKTPDGATVKEFTEIPGVETEYAAQLIVDSVM
SEDLRFIEREAVPIEEEFPEGARAFFLGEYNYGAPVHVTGHEDGKLSGLLSAVKGKEPEF
GREHVLNAEKLSKYTPSFAIARNLRLSPLTLAKITSSFSVNMDGTRVNLGLNLKFEAKKL
KVLGYSRRGNSGWEFSERAIGLLQDYMIKFPDFIAGIQRKPQGDLFEPSDFYPADIAKEK
IKEIQAWLKSIESKSFERVPLEAEQLDSSIVQAIEKSADELSQSRPSPVAQKIRGVPRNA
LLKPADAEHRLNNQHFQLGDRVLYAQDSGKVPIASRGTVVGLTRTSRNLLLDVLFDVSFM
SGTTLSDRCSPFRGSTVPSSSVLNLTSKQLIALSRATAQNKEQAREQQLPLRATPRAMSG
MGQLKDAPTPPPLVNSYRGAATGQPSNGVTARRAAAVEEEAT
Download sequence
Identical sequences D4AR50
XP_003015119.1.35196 ARB_06879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]