SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D4GSV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4GSV2
Domain Number 1 Region: 10-68,209-405
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.86e-39
Family Bacterial dinuclear zinc exopeptidases 0.014
Further Details:      
 
Domain Number 2 Region: 85-214
Classification Level Classification E-value
Superfamily PA domain 0.000000000122
Family PA domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D4GSV2
Sequence length 444
Comment (tr|D4GSV2|D4GSV2_HALVD) Putative M28 family peptidase (Homolog to aminopeptidase YwaD) {ECO:0000313|EMBL:ADE02983.1} KW=Complete proteome; Reference proteome OX=309800 OS=14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii). GN=HVO_1849 OC=Haloferax.
Sequence
MDDLSPAVREAFARTWVDDRPWAFLTDLTAIGDRMAGGPGDRRASTLVADAFTDAGVRRV
EFDPFEMARWTRGDTTLDLTAPDERRFEAVALPYAPPATVSGPLVDVGYGTPSEIDAADV
DGALVVASTTTPAGGRFVHRMEKFNYAIGAGAVGFVFVNHVPGQLPPTGALRYDEEAAAP
AVGVSAETGSWLTDYAARGGEATLAVGAETTPGESRNVEGRVGPDTDRELLLCAHFDAHD
IAEGALDNGCGIAVVVTAARLLAEMDLALGVRVVGVGAEELGLTGSEHLADRLDLDRVAA
VVNVDGAGRFRDLVAHSHTSEATAAVATRVGNETRHPVDIEPEPHPFSDQWPFVRAGVPA
LQLRSESGERGRGWGHTHADTRDKVDDRNVREHGMLTALIVRELAATAADGEIPRLDDEL
AAAFRDADFETGMKAAGIWPDGWE
Download sequence
Identical sequences D4GSV2 L9VEG3
WP_004041731.1.66890 WP_004041731.1.84848 gi|292655984|ref|YP_003535881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]