SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4HZF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4HZF5
Domain Number 1 Region: 27-254
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.15e-64
Family Phosphate binding protein-like 0.000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D4HZF5
Sequence length 257
Comment (tr|D4HZF5|D4HZF5_ERWAC) Molybdate ABC transport system, periplasmic protein {ECO:0000313|EMBL:CBA20148.1} KW=Complete proteome OX=665029 OS=Erwinia amylovora (strain CFBP1430). GN=EAMY_1198 OC=Erwiniaceae; Erwinia.
Sequence
MSVKWHHWLVAGCINLSIGGHALASGQVTVFAAASLTNALQDIASQYEKGRAVKIVSSFA
SSSTLARQLEQGAPADMFISADQQWMDYVAGKHAIDNASRVNLLGNDLVLIAPTEANPQP
VSISKSTDWKSLLKDQRLAVGDPDHVPAGMYAKEALENLGAWRQLSPLMARGNSVRAALA
LVERDETPYGIVYGSDAVASKKVKVVGIFPQDSHRPVEYPLALVKGRNNASAGAFYHYLQ
GPQAAVIFRQYGFTTLK
Download sequence
Identical sequences D4HZF5
WP_004156709.1.11283 WP_004156709.1.1383 WP_004156709.1.33884 WP_004156709.1.35084 WP_004156709.1.36353 WP_004156709.1.46807 WP_004156709.1.6082 WP_004156709.1.61414 WP_004156709.1.76509 WP_004156709.1.91631 gi|292898920|ref|YP_003538289.1| gi|292487683|ref|YP_003530556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]