SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D4HZY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4HZY3
Domain Number 1 Region: 22-195
Classification Level Classification E-value
Superfamily E set domains 1.68e-49
Family E-set domains of sugar-utilizing enzymes 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D4HZY3
Sequence length 478
Comment (tr|D4HZY3|D4HZY3_ERWAC) GlcNac-binding protein A {ECO:0000313|EMBL:CBA22591.1} KW=Complete proteome OX=665029 OS=Erwinia amylovora (strain CFBP1430). GN=EAMY_2878 OC=Erwiniaceae; Erwinia.
Sequence
MKVNKLALAITTLLVSGSVFAHGFVTNPPSRDTMCKLSKNSEEICSSSVRYDTSAIGEST
KGFPAEGTPPDGFLASGDNAKGYALNVQNADIWTKNKITAGKNNFTWELTAPHKTANFKY
FITKQGWDANKPLTRASFDLVPFCTIEGNGETPEPKPTHECVVPERTGYHVIYATWEVAD
TSNTFYKVIDVEFDGAVSSEWPKQVGTVNPYMDLKAGDSVKVRVFEDTEMTERSITLNID
SDAAGKKDLWSKALAEKINKEYQDLRAGSPNDDGGVEAVAGVNTIYTKKDSKIQSVEIDI
DSKQVMQLELDVNKLNNEYKLNKGAAKIEVTGTATAQSNLTATLTSKTRKQIDSQKVIVG
ADGKFALSLEGSKLKAGDYTVAVAVRAGNAEPVAKNQSIKLVENAGGGNVDADFTYPDNI
GSYVAGTKVLQPADGKVYQCKEGPVAGWCKIYAKSANHYEPGLGSNWGDAWTEVGAAK
Download sequence
Identical sequences D4HZY3
gi|292489346|ref|YP_003532233.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]