SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D4IJ33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4IJ33
Domain Number 1 Region: 169-286
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 7.85e-21
Family Peptidoglycan hydrolase LytM 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D4IJ33
Sequence length 288
Comment (tr|D4IJ33|D4IJ33_9BACT) Membrane-bound metallopeptidase {ECO:0000313|EMBL:CBK62945.1} KW=Complete proteome; Reference proteome OX=717959 OS=Alistipes shahii WAL 8301. GN=AL1_02490 OC=Alistipes.
Sequence
MKFLKTIRAWWRGLFRKRRFNMLNATDNTEEWHMHLSPASILAGLVAFMLMLFILTLSLV
AYSPILEFLPGYRTEADRSRESLVQNIIRLDSMERMMNDMLTYNENIALIMEGRTPVARV
LASSDSSRISKVLVMPSHEDSLLRAQMEGDGEYAIAGQGGSRRQVREAIELATPVEGIIT
GKFDIRQGNFGVKIAATAADRITAIDNGTVIQSLWTPETGYIVVLQHAGNLISVYKNLSQ
SLVTTGQTIRSGELIGYNAEVQDGEVRLFEFELWNNGKPVDPEGYIVF
Download sequence
Identical sequences D4IJ33
gi|479185360|ref|YP_007815706.1| WP_015545899.1.48748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]