SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D4JA62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4JA62
Domain Number 1 Region: 60-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000293
Family TrmB-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D4JA62
Sequence length 110
Comment (tr|D4JA62|D4JA62_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:CBK81233.1} KW=Complete proteome; Reference proteome OX=717962 OS=Coprococcus catus GD/7. GN=CC1_25950 OC=Coprococcus.
Sequence
MEFEFMSADTVLPPCMPLPAAMLRLPISSTAKVMYARLLNTTLTAGIEDSNGILFVRFPI
MELAAALSRSPVTVKRSLKELEDIGLILRVRRGVGEPNRIYTLLPKGGLP
Download sequence
Identical sequences A0A173ZQ76 A0A174MDS7 A0A174RU12 A0A174VAP0 A0A174WDJ3 A0A176U4D1 A0A1C5XE36 A0A1C5ZMD3 A0A1C6FG12 A0A1C6HQN0 A7VG09 C0FQV8 C7GGZ2 D4JA62 D4KA35 D4L4J8 D4MSN4 D6DJM2 D7GQ17 G2T4R7 R6QXC6
gi|479150144|ref|YP_007780320.1| gi|479195841|ref|YP_007825379.1| gi|479183307|ref|YP_007810420.1| gi|479139210|ref|YP_007770642.1| 2004036494 gi|479171904|ref|YP_007800091.1| WP_006859272.1.101678 WP_006859272.1.1096 WP_006859272.1.19646 WP_006859272.1.25815 WP_006859272.1.50623 WP_006859272.1.63492 WP_006859272.1.65100 WP_006859272.1.68610 WP_006859272.1.73573 WP_006859272.1.83165 WP_006859272.1.83530 WP_006859272.1.8661 gi|479338676|ref|YP_007849894.1| gi|347533364|ref|YP_004840127.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]