SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D4JR65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D4JR65
Domain Number 1 Region: 1-282
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.94e-88
Family Methylenetetrahydrofolate reductase 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D4JR65
Sequence length 286
Comment (tr|D4JR65|D4JR65_9FIRM) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome; Reference proteome OX=657319 OS=[Eubacterium] siraeum 70/3. GN=EUS_02490 OC=Ruminiclostridium.
Sequence
MKIKDLYTPGRTVFSLEVFPPNKNFPIETVYDAIEGLAAINPAYISVTYGAGGNRANRST
CEIASHIKEKYGIESMAHLTCINSTRDDVDFMLDDFAANGIENILALRGDNKPDEEPKND
FPHASDLTAYIASKGSFDIAGACYPETHVDAESAEEDIKNLKIKVDAGASHLVSQLFFDN
SCYYDFEKRARAAGVDVPIAAGIMPVTNKKQIERMVTLCGASLPSKFVKMMQKYENDPEA
LRSAGIAYAIDQIVDLISNDVQGIHLYAMNNPAVASRIYNGIKDLL
Download sequence
Identical sequences D4JR65
gi|479143623|ref|YP_007774486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]