SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5AM10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5AM10
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 8.77e-38
Family Ribosomal protein L6 0.0000278
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.92e-22
Family Ribosomal protein L6 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5AM10
Sequence length 177
Comment (tr|D5AM10|D5AM10_RHOCB) 50S ribosomal protein L6 {ECO:0000256|HAMAP-Rule:MF_01365, ECO:0000256|RuleBase:RU003870} KW=Complete proteome; Reference proteome OX=272942 OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003). GN=RCAP_rcc00315 OC=Rhodobacteraceae; Rhodobacter.
Sequence
MSRIGKKPVEMPKGVSATLSGQTIEVKGPKGTRSFTATDDVTVALDGSTVTVTPRGTSKR
ARQQWGMVRSMIENLAIGVSTGFKKELEIQGVGYRAAMQGNVLKLSLGYSHEVNFEAPAG
VTIATPKQTEITIEGIDQQLVGQVAANIREWRRPEPYKGKGIRYKGEFIFRKEGKKK
Download sequence
Identical sequences A0A0E2PH05 D5AM10
WP_013066060.1.101009 WP_013066060.1.32208 WP_013066060.1.44490 WP_013066060.1.45363 WP_013066060.1.45955 WP_013066060.1.65902 WP_013066060.1.82813 gi|294675872|ref|YP_003576487.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]