SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5AX78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5AX78
Domain Number 1 Region: 1-367
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.52e-86
Family Cystathionine synthase-like 0.00000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5AX78
Sequence length 376
Comment (tr|D5AX78|D5AX78_RICPP) NifS-like protein {ECO:0000313|EMBL:ADE30017.1} KW=Complete proteome OX=449216 OS=Rickettsia prowazekii (strain Rp22). GN=rpr22_CDS474 OC=Rickettsiaceae; Rickettsieae; Rickettsia; typhus group.
Sequence
MIYLDHNATTFIDPRVKEYIISLMDKELNPSSAHTSGRFAKNIIETARSQIATSLGITMS
REYNITFTSSGTESNNLIMKNFYDGDIFISAIEHLSIYNHINYAPNIKIIRVNKQGLVDL
EHLEDLLSQSNASKKLVSVMIANNENGVLQDIAAISKITKKYNAKFHSDLVQSFGKISLN
IKELGLDFATISGHKIGGGHGCGALISNSNFQLIPIIIGGGQEKSVRSGTENVLAIAGFG
LAAEFRRKDISKNYIKIRYLQERLEQKLKEYSNVNIISNNVARLANTTLITVDNTDAQVK
LIGFDLRNICVSSGSACSSGKISKSHVLTNMGIREEEARSSIRISLSHTNTISDIKAFIK
AFEEIYEYKSSCNHCI
Download sequence
Identical sequences D5AX78 Q9ZD59
gi|478693010|ref|YP_007749918.1| 272947.RP487 gi|383489581|ref|YP_005407258.1| gi|383487895|ref|YP_005405574.1| gi|478693496|ref|YP_007750403.1| gi|15604348|ref|NP_220864.1| gi|383487317|ref|YP_005404997.1| NP_220864.1.81248 WP_004597730.1.19079 WP_004597730.1.38548 WP_004597730.1.39958 WP_004597730.1.61965 WP_004597730.1.6643 WP_004597730.1.75108 WP_004597730.1.80123 WP_004597730.1.82014 WP_004597730.1.8209 WP_004597730.1.9355 WP_004597730.1.96644 gi|383499721|ref|YP_005413082.1| gi|383500557|ref|YP_005413917.1| gi|386082338|ref|YP_005998915.1| gi|383488741|ref|YP_005406419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]