SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5CMV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5CMV8
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.23e-68
Family Methylesterase CheB, C-terminal domain 0.000000897
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5CMV8
Sequence length 189
Comment (tr|D5CMV8|D5CMV8_SIDLE) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=580332 OS=Sideroxydans lithotrophicus (strain ES-1). GN=Slit_0554 OC=Gallionellaceae; Sideroxydans.
Sequence
MGGKIVVVGSSTGGTEALKVFLSAMPEHAPAILIAQHMPELFTRSFAERLDHLCAVHVKE
AGHHEDIVAGHVYLAPGHSHLSLECVAGKYRTVLSRDPPVNRHRPSVEVLFHSAARCLGA
NAIGVMLTGMGKDGAAAMLEMKRAGAYNFAQDEASCVVFGMPREAIALGAVDEVLPLDRI
AERVLARVR
Download sequence
Identical sequences D5CMV8
gi|291613024|ref|YP_003523181.1| WP_013028693.1.26305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]