SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5E8A4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5E8A4
Domain Number 1 Region: 1-272
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.33e-79
Family Histidine biosynthesis enzymes 0.000000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5E8A4
Sequence length 273
Comment (tr|D5E8A4|D5E8A4_METMS) ImGP synthase subunit HisF {ECO:0000256|HAMAP-Rule:MF_01013} KW=Complete proteome; Reference proteome OX=547558 OS=Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP). GN=Mmah_1897 OC=Methanosarcinaceae; Methanohalophilus.
Sequence
MLTKRIIPCLDVTLDEAGGTVVKGVEFLDLRRAGDPVELAKRYNEQGADELVFLDITASH
EGRDTMIDVIQRTANEVFIPLTVGGGIGSVERIREILRAGADKVSINTAAVKNPELVREG
ADIFGSQCIVVAIDCKRNTDVENNPDKTIIELEDGSRVWYEVVIYGGRKRTGIDAVQWAK
KVEELGAGEILLTSMDRDGTYDGFDLPITRKLSEELEIPIIASGGVGEPEHMQEGFVKGK
ADAGLAASIFHFGEYTVEDVKKHLRENNVPVRP
Download sequence
Identical sequences D5E8A4
gi|294496544|ref|YP_003543037.1| WP_013038334.1.50250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]