SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5E8F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5E8F3
Domain Number 1 Region: 9-201
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 9.43e-48
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5E8F3
Sequence length 211
Comment (tr|D5E8F3|D5E8F3_METMS) Beta-lactamase domain protein {ECO:0000313|EMBL:ADE37441.1} KW=Complete proteome; Reference proteome OX=547558 OS=Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP). GN=Mmah_1946 OC=Methanosarcinaceae; Methanohalophilus.
Sequence
MKVIQCNATTNDANSYLINDSILIDTGLNGERLAREIESHIDLNKLELIILTHCHYDHTA
AVPLLVELSGAKVGIHRADETMLADDTGSVSTFFGQKAPAIEPDILYEDGDMIKLDEIQA
LQVIHTPGHTPGGICLYEPFSKSLFSGDTVFSSGGFGRTDFEGGSARQLTESIEKLAEID
VETLYPGHGPVVKSDANRQIQLSMRASRTIW
Download sequence
Identical sequences D5E8F3
WP_013038383.1.50250 gi|294496593|ref|YP_003543086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]