SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5E9M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5E9M0
Domain Number 1 Region: 87-271
Classification Level Classification E-value
Superfamily MetI-like 3.27e-39
Family MetI-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5E9M0
Sequence length 276
Comment (tr|D5E9M0|D5E9M0_METMS) Binding-protein-dependent transport systems inner membrane component {ECO:0000313|EMBL:ADE35871.1} KW=Complete proteome; Reference proteome OX=547558 OS=Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP). GN=Mmah_0339 OC=Methanosarcinaceae; Methanohalophilus.
Sequence
MIVPQLPLGSVVEAAVYWISDTFGFALDAFSGVFKFFIDIFKDVLMAMPPLLFVVLLAVL
AYVIGRKDWKLALGTALGFIVILSMDLWEYSMETIALVISSAALALIIGIPLGILAAKSE
TLYRILRPILDLMQTMPSFVYLIPAVIFFGLGNVPGMIATVVFSMPPAIRLTTLGITQVP
TELVEVADAFGSTSWQKLIKVEIPVALKTIMAGVNQCIMLALSMVVIASMIGARGLGYQV
LIGIQRVDIGLGFEAGLGIVIIAIVLDRLTQHLTPK
Download sequence
Identical sequences D5E9M0
WP_013036814.1.50250 gi|294495023|ref|YP_003541516.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]