SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EC83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EC83
Domain Number 1 Region: 3-71,156-271
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.86e-26
Family Nitrogenase iron protein-like 0.014
Further Details:      
 
Domain Number 2 Region: 58-124
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 3.96e-19
Family Short-chain ferredoxins 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5EC83
Sequence length 292
Comment (tr|D5EC83|D5EC83_AMICL) Cobyrinic acid ac-diamide synthase {ECO:0000313|EMBL:ADE56165.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0016 OC=Aminobacterium.
Sequence
MTPKEIVIISGKGGTGKTCIMAALCSSFSGKAVFCDVDVDAPNLQLLLNPQDEQAFSFTG
RKIPEIDTERCTVCGGCVGFCRFNALEKANNGITLLPWKCEGCGGCALVCPHQAISMHSY
EQGQYWRGTTTYGPLWHARLHAGEENSGMLVARLKKESRKEALKEGVPFIVIDGPPGISC
PAISALTGATLAVAVTEPSLSGLHDLLRLSKLCASLDVPLAIVLNKSDLSEAKGEEIKNE
AKKENWHFLGSIPFRPNVVEAISKKEIPLEALSPEIDSIYNNLTNLINIIKR
Download sequence
Identical sequences D5EC83
WP_013047431.1.58668 gi|294101031|ref|YP_003552889.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]