SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5ECR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5ECR0
Domain Number 1 Region: 91-276
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.29e-32
Family Phosphate binding protein-like 0.0015
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.44e-23
Family LysR-like transcriptional regulators 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5ECR0
Sequence length 304
Comment (tr|D5ECR0|D5ECR0_AMICL) Transcriptional regulator, LysR family {ECO:0000313|EMBL:ADE56342.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0195 OC=Aminobacterium.
Sequence
MNLNQLRVFCAIVEEGSFRQAGEKLFLSQPSVSQYIAALEKNYDVKLFLRRGRSISLTPE
GRTLYILAQDLFKLVDAVPEKFREMQLLKYGELCIGTTPTCGKTFLPLIMSEYRHKFPHI
KVQIKTANEETLLTMIEKDEIELAFFGHNPLLSPSSTLTMQSLGRSSFALIAPPDHPWAQ
WKIISPAQLLEENFISYSKDTAHYCFVNDFFLNNKLKTPRLTQVDNEELLLQLVTQGFGM
GIAMEIAVRKEVKQKEVIILPLQNLAGISREIFLAHSTIKGLTYAGWEMGKIAEQITFSF
LNQG
Download sequence
Identical sequences D5ECR0
gi|294101208|ref|YP_003553066.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]