SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5ECW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5ECW0
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 4.4e-39
Family DJ-1/PfpI 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5ECW0
Sequence length 172
Comment (tr|D5ECW0|D5ECW0_AMICL) ThiJ/PfpI domain protein {ECO:0000313|EMBL:ADE56392.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0247 OC=Aminobacterium.
Sequence
MTGREIIILVEENFHDLEFWYPYYRLIEDGYEPIVVAPVAPRHYTGKFGTIVEAAYTPQS
LSENLPRGVVIPGGWAPDKLRMSGEIVSLVAQIYRSNGVVASICHGGSLLVSAGILKGKQ
VTSFASIKDDMELAGAIWVDEPVVTSEKLITSRKPSDLPFFTKALLEALQKK
Download sequence
Identical sequences D5ECW0
WP_013047658.1.58668 gi|294101258|ref|YP_003553116.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]