SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5ED04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5ED04
Domain Number 1 Region: 9-451
Classification Level Classification E-value
Superfamily Putative modulator of DNA gyrase, PmbA/TldD 2.49e-101
Family Putative modulator of DNA gyrase, PmbA/TldD 0.00000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5ED04
Sequence length 452
Comment (tr|D5ED04|D5ED04_AMICL) Peptidase U62 modulator of DNA gyrase {ECO:0000313|EMBL:ADE56436.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0291 OC=Aminobacterium.
Sequence
MIVPDRDEVESYAELAIKEALEKGACGADILFYFGSSHSLSLRDEKPEQNNSGFSVGVGI
RTLDRDGRQGVAHINTFNRSSLQQLVEWSWHNCANLEPDPWTVLYNGKSSYAKNLELKDE
KISAILPEQRQEWCAEMTHLAKKKDSRVLSVRSASWNDGEGATFYMASTGVKGWYDGSGV
AAGLSLVMSDGVNMEMGGYGEDFRFLEDISLQRIVEKAVTQTACTLGGRPIQTKRYTLVL
SPEVSASLLSVIGELFCASNVHKNRSLYKGKLGKKVASPLLSLVDDGLMPRKLGTVPFDG
EGVPSQRTVLMKEGIVEGYLYNLKHAQKDGVESTGNAARSISSLPDVDISNFYMEPGNIS
SEEIFVSVQSGIYITEFLGLHTVNPVSGDFSLGIKGVSLSGGLFAQPVAGMTIAGNLLDL
LNRIVFIGNDLSFFGDTGGCTMVIDNVTAAGL
Download sequence
Identical sequences D5ED04
WP_013047702.1.58668 gi|294101302|ref|YP_003553160.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]