SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5ED23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5ED23
Domain Number 1 Region: 9-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.64e-61
Family G proteins 0.000000189
Further Details:      
 
Domain Number 2 Region: 304-399
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.39e-35
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000735
Further Details:      
 
Domain Number 3 Region: 210-307
Classification Level Classification E-value
Superfamily Translation proteins 3.34e-32
Family Elongation factors 0.00000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5ED23
Sequence length 400
Comment (tr|D5ED23|D5ED23_AMICL) Elongation factor Tu {ECO:0000256|HAMAP-Rule:MF_00118, ECO:0000256|RuleBase:RU004061} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0311 OC=Aminobacterium.
Sequence
MAKEKFERAKPHLNVGTIGHIDHGKTTLTAAITKCLSTKGWSNFEAYDMIDKAPEERERG
ITINISHVEYQTENRHYAHIDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHV
LLARQVNVPAVVVFMNKTDQVDDDELLDLVEMEIRELLSKYDFPGDDVPIIRGSALKVLE
EGTGEENDPVSKCIWELMAACDSYIPAPQRETDKPFLMPIEDVFTITGRGTVVTGRVERG
MIKSGEEVEIVGMKADTTKTVATSLEMFRKILDEAIAGDNVGILLRGIDKEDVERGQVLA
KPGSITPHTKFKAEVYVLKKEEGGRHTPFFAGYKPQFYFRTTDVTGGIKLPEGVEMVMPG
DNATFEVDLIVPIAMEAGLRFAVREGGHTVGAGVVTEILG
Download sequence
Identical sequences D5ED23
gi|294101321|ref|YP_003553179.1| WP_013047721.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]