SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5ED68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5ED68
Domain Number 1 Region: 152-311
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000437
Family L-arabinose binding protein-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5ED68
Sequence length 456
Comment (tr|D5ED68|D5ED68_AMICL) Uncharacterized protein {ECO:0000313|EMBL:ADE56500.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0357 OC=Aminobacterium.
Sequence
MNKQKLIVLVIVLLVAVGGWMMMGNKPQEQAPAPQPQAEQPAEPAPAEKPAEAPAEAPAE
QPAEEKPAEAPAPAEKPAEAPAEKAAFHIGICTGTVSQSEDDLRGAERLIEEYGSVSDGG
MIQHITYPDNFMVEMETTIAQISGLADDPLMKAIIVNQAIPGTTEAFRRVREKRSDILLF
AGEAHEDPGVIESAADLVINCDNIARGYLIVDAAKKMGAKEFVHISFPRHMSYELLSRRR
NIMEEACNDLGIGFHFETAPDPTSDVGVAGAQQFILEKVPAWLEKYGKDTAFFCTNDAHT
EPLLKRIAEEGGYFVEADLPSPLMGYPGALGIELSDVKGDWPAILKRVEEAVDAKGGAKR
MGTWAYSYGYTTTAALGEFARRVLEGAVEVENMEALFECYGKYTPGAKWNGSLYTDIATG
VVKNNHILVYQDTYVFGLGYLGMTEVEVPEKYFSIK
Download sequence
Identical sequences D5ED68
gi|294101366|ref|YP_003553224.1| WP_013047766.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]