SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5ED93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5ED93
Domain Number 1 Region: 78-211
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.15e-25
Family GntR ligand-binding domain-like 0.0096
Further Details:      
 
Domain Number 2 Region: 10-99
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.01e-19
Family GntR-like transcriptional regulators 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5ED93
Sequence length 219
Comment (tr|D5ED93|D5ED93_AMICL) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ADE56525.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0382 OC=Aminobacterium.
Sequence
MREARLYTTSADYAYQELRHKIITKQLKPGQRLPEVNIAVQMGVSRTPVREALRRLASEG
LVIIIPNSGARLAAPTAREIEDTFLVRDQLETLAIRLAAERIGDRHLRRLEEAMIEEGRA
IEEKDLEKYLEVNEAFHKAIADASGNRVLAEYVENILARTNAYIVFYDPFYQLETMPSID
AHREILVALRHHDAEKCVKLLRGHLQEAIMGLRKAREEA
Download sequence
Identical sequences D5ED93
gi|294101391|ref|YP_003553249.1| WP_013047791.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]