SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EDC6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EDC6
Domain Number 1 Region: 5-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.74e-78
Family ABC transporter ATPase domain-like 0.0000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5EDC6
Sequence length 258
Comment (tr|D5EDC6|D5EDC6_AMICL) ABC transporter related protein {ECO:0000313|EMBL:ADE56558.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0416 OC=Aminobacterium.
Sequence
MQSAIEVKNLHKSFGNLHVLQGVSMTVGEGEVVSVIGPSGSGKSTLARCICRLEDINDGE
IYLYGQRVDNGKHSNKEVATLVGMIFQQFNLFPHLSVLDNITLCPIQAKGMKKKEAEDLA
IRLLERVGLGDKVYAKPSQLSGGQQQRVAIARALAMQPKIMLFDEPTSALDPELVGEVLE
VIAQLAETGMTMVIITHEMLFAKDVSDRIIFMADGNIVEQGSPQDIMVKPAHPRTQAFLQ
RMLVHFGEDLTKEEGGAC
Download sequence
Identical sequences D5EDC6
gi|294101424|ref|YP_003553282.1| WP_013047824.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]