SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EDD4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EDD4
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 5.89e-18
Family GalR/LacI-like bacterial regulator 0.0039
Further Details:      
 
Domain Number 2 Region: 59-160
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000000016
Family L-arabinose binding protein-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5EDD4
Sequence length 277
Comment (tr|D5EDD4|D5EDD4_AMICL) Transcriptional regulator, LacI family {ECO:0000313|EMBL:ADE56566.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0424 OC=Aminobacterium.
Sequence
MKVKMEDVAKLANVNKATVSRALKGDSRISASTRERVWKAAKALGYQPDAVARGLSSNRT
GLLGVVFVDLSQPWVGSFLSGLDRVASKQSYSLLVKCSGQGPSQKNVVARDLLSRNVDGI
IWIAGAVPDLSFDGPLVAVGSENPRGFSVLIDVERGAQKLQKIAKGRVCEVRSGSAPFFR
DIASFLKGPSLKTLPPLYVVDSSHDIPISGGGENVVLCGYPNVARLLKSYCLDWPAFELG
AIAGRLSLNAIQEKGVRPEKVMVVPPLYSPEGDIVSL
Download sequence
Identical sequences D5EDD4
gi|294101432|ref|YP_003553290.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]