SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EDE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EDE6
Domain Number 1 Region: 82-216
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 2.38e-24
Family GntR ligand-binding domain-like 0.0071
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.57e-22
Family GntR-like transcriptional regulators 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5EDE6
Sequence length 230
Comment (tr|D5EDE6|D5EDE6_AMICL) Transcriptional regulator, GntR family {ECO:0000313|EMBL:ADE56578.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0437 OC=Aminobacterium.
Sequence
MDQNTLTPATNQGLRQIVYEKLKDAIVNGVLKPGSKLSEIELAEQLAVSRTPVREAIRQL
SQTGLITLTPRRGAFVTLPSLKDASDLYELRQALEIIAIENVCENPPIKDLKLFREIFSA
MSGQTSHEEYLTEDRRFHCFLYECSGNKYLHKTLNNIVDLINLCRPYSMQSDPTIMGVFL
KGHLAIIDAVLHGDCKKAIAEMGSHIEDTKRSLLAFLRQHPGDYTSVEEE
Download sequence
Identical sequences D5EDE6
WP_013047844.1.58668 gi|294101444|ref|YP_003553302.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]