SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EDK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EDK1
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.11e-24
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5EDK1
Sequence length 66
Comment (tr|D5EDK1|D5EDK1_AMICL) Cold-shock DNA-binding domain protein {ECO:0000313|EMBL:ADE56633.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0494 OC=Aminobacterium.
Sequence
MTQGTVKWFNGTKGYGFITGEDGKDYFVHFSAIQVDGFKTLDEGQKVSFDIESGQKGPQA
ANVKPL
Download sequence
Identical sequences D5EDK1
gi|294101499|ref|YP_003553357.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]