SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EDP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EDP3
Domain Number 1 Region: 129-307,436-595
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.85e-109
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000472
Further Details:      
 
Domain Number 2 Region: 13-117
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.29e-29
Family Anticodon-binding domain 0.00024
Further Details:      
 
Domain Number 3 Region: 305-430
Classification Level Classification E-value
Superfamily GAD domain-like 7.19e-29
Family GAD domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5EDP3
Sequence length 602
Comment (tr|D5EDP3|D5EDP3_AMICL) Non-discriminating aspartyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_00044} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0539 OC=Aminobacterium.
Sequence
MSRSEHFDVSWKRTVRCGELSLDQEDNKVVLNGWVRRRRDLGGLIFIELWDYTGVTQVVI
NPELVPEVHERAKSLRSEFVISVHGKVRKRPEGTVNLSMKTGEIEVVAEDFMLLSPAAPL
PFEVSDATNKVDENLRLRYRYLDLRRDKMQRNLRIRNQIIRFTRDFLARYDFVDIETPML
TKSTPEGARDYLVPSRVNPGTFYALPQSPQIFKQILMVSGFDRYYQIVKCFRDEDLRADR
QPEFTQIDMEMSFITEEDIYALVEEFMAGLFREIAQVDIPTPFRKMDYWEAMDRFGSDKP
DLRIPFEIHDVAYIFKESDFAPFKDLLAKGGYVRGLPLPGGASLSRKEVSLVEEKAKKLG
ASGLACFQFKEGCLKGPLVKFLSEEQRQRLVEKAALHEGDAFFVLGDLNRSVASQILGQL
RLDLAKEHNLMDRDKWEFLWVVHFPLFERDEEENRWVAVHHPFTSPVIEDLPFLDSEPQK
VRSRAYDCVLNGNEIGGGSIRIHDPEIQEKVFQCLAFSREEARKRFGFLLDALSSGTPPH
GGIAFGVDRLVMLLCGASSIRDVMAFPKTQKAQCLMSGAPSFVSQEQLDELHIDSLAEED
QE
Download sequence
Identical sequences D5EDP3
gi|294101541|ref|YP_003553399.1| WP_013047941.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]