SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EDT6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EDT6
Domain Number 1 Region: 3-196
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.24e-53
Family Class I glutamine amidotransferases (GAT) 0.00000694
Further Details:      
 
Domain Number 2 Region: 180-431
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.76e-53
Family N-type ATP pyrophosphatases 0.00000731
Further Details:      
 
Domain Number 3 Region: 390-510
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.96e-46
Family GMP synthetase C-terminal dimerisation domain 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5EDT6
Sequence length 510
Comment (tr|D5EDT6|D5EDT6_AMICL) Glutamine amidotransferase {ECO:0000256|HAMAP-Rule:MF_00344} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0583 OC=Aminobacterium.
Sequence
MDNIIILDCGSQFTQLIARRIRELKVHSEIIPWDVCIDDIRQRKPRGIIISGGPQSVMDE
DSPTVPMELFEFGVPILGVCYGMQLIAKLFGGQIESGSSREYGRTAISLKDLNSLLFKSA
PGTFEVWMSHGDHIAKLPDGALLLAETDGGVPAAFAIEEKGIWGLQFHPEVAHTQNGITI
LSNFLFNICGCTGDWDLGSWIDMMVKDVQQKTENARVICGLSGGVDSTVAAVLTSKAIGD
RLECIFVNNGLLRHREAERVLEKYKQLDLNVHYVDASNRFLDALKGVIDPEQKRKIIGET
FIRVFEAEAAKIHNAEWLLQGTLYPDVIESGHKGKGASVIKSHHNVGGLPEDMKLKVLEP
LRDLFKDEVRTIGALLGVPEEIVNRQPFPGPGLAVRCLGEISRDRLDTLRAADEIFREEF
SKSETYFTVWQSFCVLLPIKTVGVMGDSRTYAEVVALRAVESSDGMTADWVRVPYDVLDR
TARRICNSIKGINRVVLDVTSKPPSTIEWE
Download sequence
Identical sequences D5EDT6
WP_013047984.1.58668 gi|294101584|ref|YP_003553442.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]