SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EDW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EDW4
Domain Number 1 Region: 41-111
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000243
Family Cold shock DNA-binding domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5EDW4
Sequence length 499
Comment (tr|D5EDW4|D5EDW4_AMICL) Ribonuclease, Rne/Rng family {ECO:0000313|EMBL:ADE56746.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0611 OC=Aminobacterium.
Sequence
MTDRKIIANTLDPEEMRVAILEKGKLVDIFVERMWERQKTGEIYKARVDSVLPGIHAAFV
NLGDGRNAFLYLNDAKGINLKPNVEVVVQVVKAARKNKGARVTSRISLPGRYLVLVPDGQ
ETGVSKRIIDEEERKRLRFLAKKLRDEGEGYGVIIRTAAEGVDEETLTHDLHTLVDLWRE
IRHDAQIQAAPCLIYRDIGLVGRVLRDELTGDVSEIVIDSEEECHKVKDYLNRILEGQEP
EVSLYEGSSPIFDFYGIERELETALDRKVWLRSGAYLIIDHTEALTVIDVNTGKYVGDTD
LRHTVLDTNLEAADEIARQLRLRAIGGIVVIDFIDMEYEEDRQKLLQRLDEVFQKDRYRA
RIFGVSQLGLVEITRKRARPDVRSVMTRGCPFCGGYGWVLKEDSVAMHIKRFLRKVSLSN
KADAMLLETHSVIAQYIADTYLAVWEEELQRRIFIAAAPEFAWNKYRLDMQGPIDVVERR
IEQMEQWEAQIRVYRTASS
Download sequence
Identical sequences D5EDW4
WP_013048012.1.58668 gi|294101612|ref|YP_003553470.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]