SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EDY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EDY3
Domain Number 1 Region: 126-272
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.5e-59
Family C-terminal domain of ribosomal protein L2 0.00000342
Further Details:      
 
Domain Number 2 Region: 3-125
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.85e-49
Family Cold shock DNA-binding domain-like 0.00000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5EDY3
Sequence length 275
Comment (tr|D5EDY3|D5EDY3_AMICL) 50S ribosomal protein L2 {ECO:0000256|HAMAP-Rule:MF_01320} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0630 OC=Aminobacterium.
Sequence
MSIKEFKPYTPGRRAMSSQSFDEVTKSEPERALTTALKKAGGRNNLGRITMRHRGGGMKR
LYRIIDFKRDKIGVPGKVAAIEYDPNRSARIALIHYLDGEKRYILAPADLSVGDMVVAGP
ESDIKPGNALKLKDMPVGTVVHNIELEPGCGGKAVRSAGTSAQLMAKEGKYAYIRMPSGE
LRLVLNECMATVGQVGNVEHENISLGKAGKTRLLGRRPKVRGVVMNPVDHPLGGGEGRSK
SHKHPVSPWGTLAKGYRTRKNKPSDRLIVRRRYAK
Download sequence
Identical sequences D5EDY3
gi|294101631|ref|YP_003553489.1| WP_013048031.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]