SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EE04 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EE04
Domain Number 1 Region: 4-72
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.39e-29
Family Cold shock DNA-binding domain-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5EE04
Sequence length 73
Comment (tr|D5EE04|D5EE04_AMICL) Translation initiation factor IF-1 {ECO:0000256|HAMAP-Rule:MF_00075} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0651 OC=Aminobacterium.
Sequence
MANKDDVIEVRGTVIEPLPNAMFRVELENGHKILAHVSGKMRMHFIRILPGDKVLVEISP
YDLTRGRIVYRYK
Download sequence
Identical sequences D5EE04
gi|294101652|ref|YP_003553510.1| WP_013048052.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]