SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EE11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EE11
Domain Number 1 Region: 8-233
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.61e-59
Family ABC transporter ATPase domain-like 0.0000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5EE11
Sequence length 277
Comment (tr|D5EE11|D5EE11_AMICL) ABC transporter related protein {ECO:0000313|EMBL:ADE56793.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0658 OC=Aminobacterium.
Sequence
MTPKIVCTLQGVGFSYPEADSSALDQVSFQVREGEWLALLGSNGSGKSTLAKHLNALLLP
SQGACFVYGMDTREEKNLWAIRSHVAMVFQNPDNQIVGTVVEDDTAFGPENIGLSPLEIR
QRVDWALSVTGLSHKMQNPTYSLSGGEKQRLAVAGALALDPPCLVLDEPTAMLDPQGRRD
LLDVLKTLHAQGRTIIYITHRLEETVHCDRALVLKSGKVQWDGTISELFRHTEKLNEWGL
ECPPFIELWQMLVAERLISEKTPATVDGVQKALCQLL
Download sequence
Identical sequences D5EE11
gi|294101659|ref|YP_003553517.1| WP_013048059.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]